GenomeNet

>cbh:CLC_2219 K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] | (RefSeq) tgl; transglutaminase (A)
MIKISGNTVTRDKIVAKYPPNSLERKIAEQLSSNQDVHNYDSLNQLEFDIKLRANIVESA
RELDRSDLSFTTFRRSRCNRDYWQRTDEGGFLLKEYVKASDAIKDIFINTSKYGTECATA
IVIIYYKALLNVLPEQLFNEMFPSIYLFDWQYLDRNLHVESYGGVTEFFPGDCQYFKNPD
VNPATPEWQGENVINLGNGTYYGHGIGITSANGIIRELNRNRRRGATESAFLTDSVTRLN
SKEIFDKYYNFSSTMRIKRSREIHRGYPNYLYY

BLAST