GenomeNet

>cbm:CBF_2335 putative protein-glutamine gamma-glutamyltransferase; K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIKISGNTVTRDKIIAKYTPNSLERKIAEQLSSNQDVHNYDSLNQLEFDIKLRANIVESA
RELDRSDLSFTTFRRSRCNRDYWQRTDEGGFLLKEHVKASDAIKDIFINTSKYGTECATA
IVIIYYKALLNVLPEKLFNEMFPSIYLFDWQYLNRNLHVESYGGVTEFFPGDCQYFKNPD
VNPATPEWQGENVINLGNGTYYGHGIGITSANGIIRELNRNRRRGATESAFLTDSVTRLN
SKEIFDKYYNFSSTMRIERSRGIHRGYRNYLYY

BLAST