GenomeNet

>cbr:CBG00344 K01113 alkaline phosphatase D [EC:3.1.3.1] | (RefSeq) Hypothetical protein CBG00344 (A)
MILRVFAIFATIFVAVSSKKVEQVHLSLSGKQDEMMVTWLTQDPLPNVTPYVAFGVTKDA
LRLTAKGNSTGWADQGKKKVMRYTHRATMNSLVPGQVYYYQVGSSQAMSDVFHFRQPDQS
LPLRAAIFGDLSIYKGQQSIDQLIAARKNNQFDLIIHIGDLAYDLHDNDGDNGDDYMNAI
QDFAAYVPYMVFAGNHEVDSNFNQIVNRFTMPKNGVYDNNLFWSFDYGFVHFIALNSEYY
AEEMSKETQLQYKWLENDLAGNSKKWTIVMFHRPWYCSSKKKKGCHDDQDILSRDGLKDK
FPGLEELLNKYKVDLILYGHKHTYERMWPIFNAQPFKSQDPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIIQDFSVKALGEYGYTFLTVYNSTHLSTDYVDTSETSGEFLDPFVLEKD

BLAST