GenomeNet

>cbr:CBG00344 K22390 acid phosphatase type 7 | (RefSeq) Hypothetical protein CBG00344 (A)
MILRVFAIFATIFVAVSSKKVEQVHLSLSGKQDEMMVTWLTQDPLPNVTPYVAFGVTKDA
LRLTAKGNSTGWADQGKKKVMRYTHRATMNSLVPGQVYYYQVGSSQAMSDVFHFRQPDQS
LPLRAAIFGDLSIYKGQQSIDQLIAARKNNQFDLIIHIGDLAYDLHDNDGDNGDDYMNAI
QDFAAYVPYMVFAGNHEVDSNFNQIVNRFTMPKNGVYDNNLFWSFDYGFVHFIALNSEYY
AEEMSKETQLQYKWLENDLAGNSKKWTIVMFHRPWYCSSKKKKGCHDDQDILSRDGLKDK
FPGLEELLNKYKVDLILYGHKHTYERMWPIFNAQPFKSQDPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIIQDFSVKALGEYGYTFLTVYNSTHLSTDYVDTSETSGEFLDPFVLEKD

BLAST