GenomeNet

>cbr:CBG00344 Hypothetical protein CBG00344; K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MILRVFAIFATIFVAVSSKKVEQVHLSLSGKQDEMMVTWLTQDPLPNVTPYVAFGVTKDA
LRLTAKGNSTGWADQGKKKVMRYTHRATMNSLVPGQVYYYQVGSSQAMSDVFHFRQPDQS
LPLRAAIFGDLSIYKGQQSIDQLIAARKNNQFDLIIHIGDLAYDLHDNDGDNGDDYMNAI
QDFAAYVPYMVFAGNHEVDSNFNQIVNRFTMPKNGVYDNNLFWSFDYGFVHFIALNSEYY
AEEMSKETQLQYKWLENDLAGNSKKWTIVMFHRPWYCSSKKKKGCHDDQDILSRDGLKDK
FPGLEELLNKYKVDLILYGHKHTYERMWPIFNAQPFKSQDPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIIQDFSVKALGEYGYTFLTVYNSTHLSTDYVDTSETSGEFLDPFVLEKD

BLAST