GenomeNet

>cbr:CBG04588 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) Cbr-hda-1; C. briggsae CBR-HDA-1 protein (A)
MNSNGPLQEHGKRRVAYYYDSNIGNYYYGQGHVMKPHRIRMTHHLVLNYGLYRSMEIFRP
FPATFDDMTRFHSEEYMLFLKSANPDNLKSFNKQMLKFNVGEDCPLFDGLYEFCQLSSGG
SLAAATKLNKQKVDIAINWMGGLHHAKKSEASGFCYTNDIVLGILELLKYHKRVLYVDID
VHHGDGVEEAFYTTDRVMTVSFHKYGDFFPGTGDLKDIGAGKGKLYSVNVPLRDGITDSS
YQSIFKPIMTKVMERFDPSAVVLQCGADSLNGDRLGPFNLTLKGHGECARFFRSYNVPLM
MVGGGGYTPRNVARCWTYETSIAVDREVANELPYNDYFEYFGPNYRLHIEQSNANNENNP
ELLTKLQADVIANLEKLTFVPSVQMRPIEDDALRSMNDSSALVDMADPDRRLPAEVTDQM
IQDEGDFYDGEREGDDRRNESDGKRAAQLDSEGGK

BLAST