GenomeNet

>cbr:CBG09063 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) Hypothetical protein CBG09063 (A)
MVAPAPLRDQSKRRVCYYYDTNVGNYYYGPGHVMKPHRIRMANELILSYGLYQNLSIYRP
RPASFEAMTTFHSDEYITFLRDANIDNLNSFGASKGKFSQNNDDCPLFDGLYEFCQLSCG
GSLAAAIKLNKKKTDIAINWMGGLHHAKKSESSGFCYTNDIVVGILELLKFHKRVLYVDI
DIHHGDGVEEAFFDTNRVMTVSFHRFGNFFPGTGDIKDVGIYNGRLYSVNVPLSDGITDE
SYERIFVPVMKKVMEMFDPQAVVLQCGADSLYGDRLGKFNLSLRGHGACAEFFRKYDVPL
MMVGGGGYTPRNVARCWAYETSIAVGIEVPNELPFNNYYEYFGPDYKLHIEPSQVLKNDN
PDQKLLELQKEIFENLSQLDKVPSVQMQPMEDDTLPVLEFEDIARDEENPDVRLPMSIMD
SCQHNDADFYDDENGGDDHRNEANGLRQAEAENNL

BLAST