GenomeNet

>cbr:CBG09063 Hypothetical protein CBG09063; K06067 histone deacetylase 1/2 [EC:3.5.1.98] (A)
MVAPAPLRDQSKRRVCYYYDTNVGNYYYGPGHVMKPHRIRMANELILSYGLYQNLSIYRP
RPASFEAMTTFHSDEYITFLRDANIDNLNSFGASKGKFSQNNDDCPLFDGLYEFCQLSCG
GSLAAAIKLNKKKTDIAINWMGGLHHAKKSESSGFCYTNDIVVGILELLKFHKRVLYVDI
DIHHGDGVEEAFFDTNRVMTVSFHRFGNFFPGTGDIKDVGIYNGRLYSVNVPLSDGITDE
SYERIFVPVMKKVMEMFDPQAVVLQCGADSLYGDRLGKFNLSLRGHGACAEFFRKYDVPL
MMVGGGGYTPRNVARCWAYETSIAVGIEVPNELPFNNYYEYFGPDYKLHIEPSQVLKNDN
PDQKLLELQKEIFENLSQLDKVPSVQMQPMEDDTLPVLEFEDIARDEENPDVRLPMSIMD
SCQHNDADFYDDENGGDDHRNEANGLRQAEAENNL

BLAST