GenomeNet

>cbr:CBG09630 Hypothetical protein CBG09630; K11418 histone deacetylase 11 [EC:3.5.1.98] (A)
MAEREEEENYNLEEHQRPIVYHSEYNVSAFGIEHLHPFDSSKWKRVIAHLKDMNLITDAT
TVEPSLPTFEELTRVHDRKYLKSVRNPLKAAQIVEIPLVGCLPPCVIETGGSVLAANLAL
KHGWAINVGGGFHHASYSDGGGFCFYADITMAICDLFDKKAITNAIVVDVDAHQGNGHAR
DFANNENVFVFDVFNPYVYPHDREARQFINKAVHVNSHTTDTSYISELRKQLTQCLENRQ
NLTPPGFDFILYNAGTDCLFGDPLGAMNLSPQCIISRDEVVFKLAREKGIPICMLTSGGY
QKNNAHLIAKSIENLHSKNLINLGIN

BLAST