GenomeNet

>cbr:CBG09958 Cbr-gpdh-2; C. briggsae CBR-GPDH-2 protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MSPKKVTIIGSGNWGSAIARIVGNTTKSFPDQFDPQVRMYVYEEIVNGEKLSEVINTRHE
NIKYLPGKILPENVVAVTDLVKSCEGSNILIFVVPHQFVKGLCEKLVGKIPADTQAISLI
KGVSTGGIERGGLKLISEEIKEILKIEVSVLMGANLAPEVANDNFCEATIGCKRKAEDGP
LLKKLFHTDNFRINVVEDAHTVELCGALKNVVACAAGFTDGLGYGDNTKAAVIRLGLMET
TKFVEHYYPGSNLETFFESCGIADLITTCYGGRNRKVCEAFVKTGKTLAEVEKELLNGQS
AQGPLTAEEVYLMMKKTGLDAKFPLFTAVHKICAGEMKPAELVDCLRNHPEHM

BLAST