GenomeNet

>cbr:CBG14607 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) Cbr-acn-1; C. briggsae CBR-ACN-1 protein (A)
MKFNILLLLLVGACLPSFSQEIKPKSELLPGDEAPKDPEVAFAEGEPFELTDALDTPKNG
TVPVPEPEPKPEPEPEPEPEPSPKSEPEPEPTPEPEPAIKFDNIESEDYGDVAEAVVTQP
DELNTEVIEQLVDTFLNTGSIAPNKTNKGPVYANPVAQALVNSSDYWKADNLQAPGSIKD
EEKLRSWLAGYEAEAIKVLREVALSGWRYFNDASPSLKLALDEAENVLTMFVKSTSMQAK
QFDKASVTDERLKRQLGYVSFEGMSALAPSRFAEFSQAQSTLNRDSKDSTICDKDVPPPC
ALQKIDMDSIFRNEKDASRLQHLWVSYVTAIAKSKPAYNNIIAISNEGAKLNGFANGGAM
WRSAFDTPSNMADLTKQVEKIYSTIQPFYQLLHAYMRRQLAGIYSNPAGLSKDGPIPAHL
FGSLDGGDWSAHYEQTKPYEEESETPEAILAAFTSQNYTTKKMFVTAYRYFKSAGFPQLP
KNFWTSSIFARVWSKDMICHPAAALDMRAPNDFRVKSCAQLGEPDFEQAHSLLVQTYYQY
LYKDQSLLFREPASPVITDAIASAFAYLATNPHYLYSQKLVPSDHLDIKNSVIINKLYKE
SLESFTKLPFTIAADNWRYELFEGKVPKNKLNDRWWEIRNKYEGTRSPQPYNTSNLDALI
HNSVSQVNSPATRSLISYVLKFQILKALCPEGTILSEGCILSEDTTEKLRETMKLGSSIT
WLKALEMITGKGELDAQPLLEYYEPLINWLRNTNEIDQVVIGWDGEGTPFTVEEIPKTRQ
PGDGGNGLPSEDRVAFPGGECVNGQECLLDSHCNGTICVCNEGLFTLEIGNTFNCVPGNP
ADSGFGDGKGGLVIGLFNNEATTPEPAAEPEPTTVTSTKMPPRVRSSAALPTFLLTVLPV
FYYLL

BLAST