GenomeNet

>cbr:CBG15755 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) Cbr-unc-25; C. briggsae CBR-UNC-25 protein (A)
MSSPVKDEQSDAMLEALIAKEILPQSGNWEGTEEFLNRVVQVLLKYIKDQNDRDQKILEF
HHPDKMQMLIDLSIPEQPENLLKLVKSCEDVLRLGVRTGHPRFFNQISCGLDLVSMAGEW
LTATANTNMFTYEIAPVFILMEKSVMTRMWEAVGWDPEKADGIFAPGGAIANLYAMNAAR
HQLWPRSKHLGMKDIPTLCCFTSEDESHYSIKSASAVLGIGADHCFNIPTDKNGKMIPEA
LEAKIIESKKEGLTPFFVCCTAGTTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLS
PEHRYKLAGVERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQASADYLFQQDKPYD
VSYDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLSAYFTRRIKETEGFELI
IENPEFLNICFWYVPSKIRNLEPAEIKARLEKIAPKIKAGMMQRGTTMVGYQPDKQRPNF
FRMIISNQAITREDLDFLIKEIVDIGESLE

BLAST