GenomeNet

>cbr:CBG16282 K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] | (RefSeq) Hypothetical protein CBG16282 (A)
MARGCPFTKKTKRAPKKSATSITGDGENNVVPNMAPKKIRKPRDENQWKITDFYEVRKSG
RKTEKQLQDEAQKAVAEKVLKGSNEELLQVFHDADKGRCICSTVNFQKDEFVIEYKDKAV
RYLASQKENTKYTFYFKKLILSENRIVFTYLVFGFGNGKNTMVLEFDPKSGQLNYGYNQQ
CIDY

BLAST