GenomeNet

>cbr:CBG16282 Hypothetical protein CBG16282; K11428 histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43] (A)
MARGCPFTKKTKRAPKKSATSITGDGENNVVPNMAPKKIRKPRDENQWKITDFYEVRKSG
RKTEKQLQDEAQKAVAEKVLKGSNEELLQVFHDADKGRCICSTVNFQKDEFVIEYKDKAV
RYLASQKENTKYTFYFKKLILSENRIVFTYLVFGFGNGKNTMVLEFDPKSGQLNYGYNQQ
CIDY

BLAST