GenomeNet

>cbr:CBG18689 K06067 histone deacetylase 1/2 [EC:3.5.1.98] | (RefSeq) Cbr-hda-3; C. briggsae CBR-HDA-3 protein (A)
LLHSKSRVSYYYDGDFGNFYYGQGHPMKPHRVRMTHSLIVNYGLYRKLTVMRPAPASFSE
ITRYHSDDYVNFLRSVRSDNIQSLADQMARFSVGEDCPVFDGLYEFCQLSCGGSLAAAAK
LNRKESDIAINWMGGLHHAKKSEASGFCYSNDIVLAILELLKEHKRVLYIDIDVHHGDGV
EEAFYTTDRVMTVSFHKHGEYFPGTGDLKDVGAGKGKYYALNVPLRDGVDDFTYERIFRT
VMGEVMARFQPEAVVLQCGADSLAGDRLGVFNLTTYGHGNCVEYMKSFNVPLLLVGGGGY
TIRNVSRCWLYETSLALDLDVPNELPFNDYFDYFIPDYKLHIKPLPHLTNYNTQEFIDQT
IVSLLDNLKLMTHVPSVQMQPLPTTSDRIVKTFDENLRRDHQDDDVRNSQLDQDVGIEHA
SEFYDEQEATRNTHKRQRFESQTEASEDAKKTRVDGEE

BLAST