GenomeNet

>cbr:CBG19465 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) Hypothetical protein CBG19465 (A)
MSSIVCHPIIKNGIATDARIKKQRPPPLVVARPRDLIQEACERLVLSDQQLRRIMVLMEK
SMEQGLSGKKAAVKMLPTYVDAVPNGTEKGDFLALDLGGTNFRVLHIKLEGKETKMTGKI
FRVPESIMRGTGEALFDHIADCMAKFMEENNLKDATKLPLGFTFSFPCEQDGLTRGKLVT
WTKGFKASGVEGADVVTLLRDACHRRKDIDIDVVALLNDTVGTLMACAFQENTCQIGVIV
GTGTNACYMERLDRIPKLAGYVDEHNVTPEEMIINTEWGAFGDDGALSFLRTKWDDAVDR
ESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGHSDAISTPHCFPTKFVSEIDS
DLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRIN
KKHVTVGVDGSVYRFHPTYPTLLDAKIAELIVGDIEYKLMLSEDGSGRGAALVAAVATRL
KEEKLAAAATASER

BLAST