GenomeNet

>cbr:CBG19465 Hypothetical protein CBG19465; K00844 hexokinase [EC:2.7.1.1] (A)
MSSIVCHPIIKNGIATDARIKKQRPPPLVVARPRDLIQEACERLVLSDQQLRRIMVLMEK
SMEQGLSGKKAAVKMLPTYVDAVPNGTEKGDFLALDLGGTNFRVLHIKLEGKETKMTGKI
FRVPESIMRGTGEALFDHIADCMAKFMEENNLKDATKLPLGFTFSFPCEQDGLTRGKLVT
WTKGFKASGVEGADVVTLLRDACHRRKDIDIDVVALLNDTVGTLMACAFQENTCQIGVIV
GTGTNACYMERLDRIPKLAGYVDEHNVTPEEMIINTEWGAFGDDGALSFLRTKWDDAVDR
ESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGHSDAISTPHCFPTKFVSEIDS
DLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRIN
KKHVTVGVDGSVYRFHPTYPTLLDAKIAELIVGDIEYKLMLSEDGSGRGAALVAAVATRL
KEEKLAAAATASER

BLAST