GenomeNet

>cbr:CBG23008 Cbr-alh-1; C. briggsae CBR-ALH-1 protein; K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] (A)
MLRSLLKASAQQARNASNVPPGLANMKPQYTGIFINNEFVPAKSGKTFETVNPANGRVLA
NVAEGDKADVDIAVKAARKAFQVGSEWRRMDASQRGVLLNRLADLMERDRVILASLESLD
NGKPYAIAYAADLALSIKTLRYYAGWADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWN
FPLLMQAWKLGPALAMGNTVVMKVAEQTPLSALHVAALTKEAGFPDGVVNVIPGYGHTAG
QAISSHMDVDKVAFTGSTEVGRLVMKAAAESNVKKVTLELGGKSPNIIFADADLDEAVAQ
ANHGLFFNQGQCCCAGSRTFVEGKVYDEFVARSKALAEKAVIGDPFDLKTTHGPQVDGKQ
VDTILKYIASGKKDGAQLVCGGIKHGEEGHFVKPTIFANVKDEMTIAQEEIFGPVMSIIR
FDSMEELVEKANNTIYGLAAGVMTKDIDKALHIANTTRAGSVWVNCYDVFDAAAPFGGFK
QSGIGRELGEYGLEAYTEVKTVTIKVPQKNS

BLAST