GenomeNet

>cbu:CBU_1934 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (RefSeq) DNA ligase D (A)
MILLSLKHYRQKRDFTKTSEPQGESASSSQQFIYVIQKHDASHLHYDLRLELDGVLKSWA
VPKGPSLNSDLKRLAVEVEDHPIDYATFEGNIPKGQYGAGPVIVWDKGTWQPEGNAKENL
KKGKLVFIINGEKLKGKWALVRLKTDDYKNNWLLIKKKDHYATERFDIDNYPLSVISGAS
IEEIKNHKLALSLSDLKNAKKTVVPEFIQPQLAKLKTVVPDSPDWIHEIKFDGYRIICII
KKGIIQLMTRNQKNWTEKLAGLAETMKSIPIDESILDGEIVVFDESGKTDFQLLQNAIKA
KKYNEIKYYLFDIPFCQKFDLSQVPLIMRKRLLKKLILQWKEKSGSILYSSHIKGNGKAI
LERACELGLEGIISKKIDAAYEQRRSSSWIKLKCKRQQEFVIGGYTKPRGEQLYFGALLL
GYYQNKKLIYCGRVGTGFSSLSLKDIYEKLINREQKAPAFSELPTFGIKAGNHWVKPELV
AEIEFAEWTKDKRLRQPVFKGLREDKEAKGVKLETVKKTTVKNKPNNIKLTNPEKILYPE
EKITKRQLADFYSKIADRLLPHIVHRPLMLLRCPNGYNKECFFQKHPDQNGEEFVYSVEI
EEKERKRYLTIHDEKGLLALVQMGVLEIHPWGSSDSHPEKPDRLIFDIDPHPAVSWKAVI
NCATDVFEVLKALGLRSFVKTSGGKGLHVYVPIQPQLGWEKLHEFAQKLAKLIVQVNPRL
YTAELSKGKRLNKIFIDYIRNNRGATCVAPYSTRAKKHVPLSTPVSWDELSAVKSPTQFT
IKNIFHRLEALNQDPWEEFFDIKQSITASMWKFFS

BLAST