GenomeNet

>cce:Ccel_1239 family 6 carbohydrate binding protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MLRKKILCIFLVTVLMLTILPIPQQTVMADTGVLKELKGTDIYNGLRGLNFNEGWKFNKG
DVSNGQSTGYNDSGWSGVTLPHDWSIYNTFNKSSAAGAGGGYLDGGIGWYRKTFTVPSDY
TGKKVFIEFDGAYMNSQVWINGTLLGTRPYGYSSFEYDLTPYLNIGGSNVIAVRLNNNQP
TSRWYSGSGIYRNVWLTVLDPVHVTYCGMFVTTPTVSSSSATANVSTKVLNQGSTAKSVS
LKTTITDAEGNVVATNTSSVASIAGSGSNTFSQNLTVSNPHLWSPASPYLYAVQTQVIVD
GNVTDTYSSTLGIRYFSFSSTSGFSLNGVNMKINGVCLHHDLGSLGAAVNYRAIERELQI
MKDMGCNAIRTSHNPPDPQMLEICDRLGLMVMDEAFDCWETGKNSNDYHLYFNNWAQTDL
QAMVTRDRNHPSIIMYSIGNEIPSPSVATATKLKNWVKDVDNTRPVTLGTFAVSMGDATP
QAVASVLDLVGYNYFPYMYDGGHNNHPEWKMFGSETSSAVRSRGVYKTPTNKNILTDSDN
QCSSYDNSVVSWGNSAESSYNEINKRNYMAGEFIWTGFDYIGEPTPYEWPAKSSYFGIVD
TCGFPKDIYYFYQSKWSTKPMVHILPHWNWSTGTNVEVWAYSNCDTVELFLNGKSLGSKS
VGTAGHLSWSVPWSSGTLRAKGTKGGTVVYDEVVTAGTPSKVLLKPDRTSVKADGKDLIY
IETDIADGNNVTVPTADNTVNFSISGPGVIVGVDNGNPISTEAYKGSSRKAFNGKCLVIV
QPTKVNGTIVVTASSNGLSSGSVSIASTGGAEAPIVSAYKKIEAENYDNQSGIQTEACSE
GGQDVGFIENGDYTVYNNVDFGSGAESFTARAASATSGGNIEIRLDSPNGTLIGTCPVAG
TGDWQTYADVNCSVSEVSGKHDLYLKFTGDSGYLFNINWFTFTARNSAKLGDLNSDDQID
AMDFQLMKKYLLGLGEIKDTKLADLDASGTIDVLDLMLLKQYLLGTITSFPGQGT

BLAST