GenomeNet

>cch:Cag_0333 type II restriction endonuclease TdeIII (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MSLNQQQIQKVETVLRNSLRHKFQNYNPEPAVMPFHTRLLGKDRMALFSFIHSLNTNFGT
TIFEPVAQALALSRFGSVELQKVAGNQISLQAQQVIQEIMDGLTTATNLPCKSQEIEAIR
AVCQSGEMRKVKPTKVDVKLISYDGTLFLIDIKTAKPNKGGFQEFKRTLLEWVAVTLATN
PEATIETFIAIPYNPYEPKPYSRWTMRGMLDLEAELKVAEEFWDFLGGEGTYPQLLDCFE
RVGCELRSEIDAYFAQYINS

BLAST