GenomeNet

>cch:Cag_0333 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) type II restriction endonuclease TdeIII (A)
MSLNQQQIQKVETVLRNSLRHKFQNYNPEPAVMPFHTRLLGKDRMALFSFIHSLNTNFGT
TIFEPVAQALALSRFGSVELQKVAGNQISLQAQQVIQEIMDGLTTATNLPCKSQEIEAIR
AVCQSGEMRKVKPTKVDVKLISYDGTLFLIDIKTAKPNKGGFQEFKRTLLEWVAVTLATN
PEATIETFIAIPYNPYEPKPYSRWTMRGMLDLEAELKVAEEFWDFLGGEGTYPQLLDCFE
RVGCELRSEIDAYFAQYINS

BLAST