GenomeNet

>cci:CC1G_06084 succinate dehydrogenase flavoprotein subunit; K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] (A)
MLAARSVRRSLLGHARAFHASSKVSRVVATNPVKAQEVKGWGKYPLIEHEYDAVVVGAGG
AGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMCREAPNTVIELEHFGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHAILHTLYGQSLRHDTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPQQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHIYLQLSHL
PPDILHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTRYTGEVITVDENGNDK
VVPGLYAAGEAASVSVHGANRLGANSLLDIVVFGRAVAHHIRDTWTPGKPHKTIPEESGL
ESIEFLDKIRRADGPEPTAKIRLDLQKAMQADAAVFRTQESLDEGVEKVREIYNNFKNVG
IKDRSMIWNSDLVETLELRNLLQCAIQTIVSAAARKESRGAHAREDYPERDDENWMKHTL
SYQPDVESPDVKLAYRRVIETTLDENECKPVPPFKRVY

BLAST