GenomeNet

>cdt:CDHC01_0286 hypothetical protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MTTTTGALTITFATTCDGPLAHIPHHLDLNIIHGRIQGTTAHRRIDAEDPDGLDDGLPHH
LCLSVDTTGTHLFIDGYEAFSTTQTEWFDTSELTLNPHGDLTIIDHQILNHAPTPRQARN
LAPAAEPLVWFAGSHLSTRDTQRISHLTHGSLRLLMKTRGTGQGGVAFQAHTINGDLTLE
IIDGTLIFSVRCHDEDYVRITAPGRWDDGHIYDVVIVCGRGATDIYVDGQQLIHSPGAAF
FNDLSGELSVHIGTSASGVRLFGEVQSGMIYPHVFNHHQVQRLATVEPIATQALFDCLLD
GAQSYRIPSLITTDSGVIIAGADKRVSIANDAPNDIDFVLRRSVDGGRTWQPPRTILQLP
DTACVTDSVLLQDHTTGRIFAFLDQFPAGIGQPNAAFGTGFDADGNRIGHFADGSTCTMP
REVDQLEASFFSDPHTAPPGIVFQHPSCHLWMLTSDDDGLSWSTPRDLTPDVKEEWMRFC
GTSPGNGIQLQRGTHAGRLLIPMYYTKGDQFFAAALYSDDHGDTWHRGESPDLEMYESTL
VEASDGSVLLWARNQHPSGAVAHARSTDGGHSWSQVTFNPNVPEIFSQPNALRVTNPDGI
IFANASQLLPFRGRGVLRMSTNDGASWQHNRVFNPRHYVYQCMTQLPDGSIGLLWEREMQ
GLFFSIIPMTWIMQGYAL

BLAST