GenomeNet

>cdu:CD36_19280 protein ure2 homologue, putative; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MMSIDQRVQQTMNDNNNNPSNNNNSNNNNTNNQNVNNNSNNNNTHTISNLSAGLKSVSLT
DQQQNEVNLNLLQQQLHQEASTQQQQSRITQFFQNQPTEGFTLFSHRSAPNGFKVAIILS
ELNLPFNTFFLDFNNGEQRTPEFVTINPNARVPALIDHYNDNTSIWESGAITLYLVTKYL
KENGECSLWSNNLIEQSQISSWLFFQTSGHAPMIGQALHFRYFHSCPVPSAVERYTDEVR
RVYGVIEMALAERREALIMDLDVENAAAYSAGTTPLSQSRFFDHPVWLVGDRTTVADLSF
VPWNNVVDRIGINLKVEFPEVYKWTKHMMQRPAVKRALRGD

BLAST