GenomeNet

>cdu:CD36_24310 SET domain-containing protein, putative (EC:2.1.1.43); K11423 histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43] (A)
MSNNNPQESSNNSNSPLKRSTPMLFLDAEDKTQEALTTFELLNACTYQNKYVGSANVTTT
TTNKTSGSTSTKSHQQQQQNRRKLEFMTCDCEEEWDSELQMNLACGPDSNCINRITCVEC
INKNCLCGDDCQNQRFQNCQYSKVKVIQTELKGYGLIAEQDIEENQFIYEYIGEVIDESS
FRQRMIEYDLRHLKHFYFMMLSNDSFIDATQKGSLGRFINHSCNPNAFVDKWHVGDRLRM
GIFAKRKILRGEEITFDYNVDRYGAQSQPCYCGEPNCIKFMGGKTQTDAALLLPQMIAEA
LGVTPRQEKAWLKENKSIRNQQQNDESNINEEFVNSIEIDPIENQDGVTKVMSALMKTQH
PLIIKKLIERISVSSGHDAINVMFVRFHGYKTISTILQDLLVSKNNDKESETNDHDNNKD
SIEDKDELIIKILKILVTWPAVTKNKISSSNLEEVVKDIQTSNESSNNKEEINELCTSLL
ERWSKLEMAYRIPKQESAIANNATAGTATTTATGTSASPFERISSHTPELGATNTPTSSS
QQQQQSRDAGLPENWRSAFDKNTGGYYYYNTVTQETTWERPLGSLPLGPKPPSGPGIKGR
LNKYNEIDLAKREELRIQKEKEMKFIEMQNRDRKLKELIEMSKKSMNNSANNFNGFSDNG
DNNGNTNTTSTTGGVYGITSDKQGGKHHHDKHSKNGPRNTSISTSTSDSGSGNIEKTWKR
IFAKYIPNIIKKYESEIGRDNVKGCARELVNVLTQSEIKHGKKPPSNDSNMELNDKKLKK
IKEYSYRYMDKFLIKFNNSKKNKSITGSNGGDSDKHKRKHDDDDGNDGENGVKRSKV

BLAST