GenomeNet

>cdu:CD36_65510 NAG5; N-acetylglucosamine kinase, putative; K00844 hexokinase [EC:2.7.1.1] (A)
MIETSIESVGGLTSGPMYFMEIVSSQSSVLSSIVESFTSAVSASNLGVYSEELLGDVKHS
LRENSPITMLPNYNISPTGEEHGSYLVIDLGGSTLRIAVVDISKPHPKLSRTERITIVVE
KSWIIGNDFKRIDYEFFKYIGSKINEILVGQNVIDVNSVINTGITWSFPLETTNYNSGRI
KHVSKGYTVGEDIYGKDLKTVLEETLRQEYGLALEVNSILNDSLAVYSAGCFIDSNMKLA
MVLGTGINMCCSLKKSSEICRYKMLADATLFNCELSLFGQNLCKDFATKYDSIIDQRFAR
TQHHFKTFMGPDPLTQTLFQPHELMTSGRYLPELTRLVVVDLIEAGEIFQNVDCQSFYEE
YGGFSGELMCFVHETDDYNDIHVKLCKAYGWTGIGRSDVVCLKEVVSCIIKRAAFIVANA
IIAFFKLLGGDELCGDVTIGYVGSVLNYFHEYRRLIIEYVNNAAEAKQLGVTIDLKLIDN
SSIIGAAIGAAYYR

BLAST