GenomeNet

>cel:CELE_C01B4.6 C01B4.6; Protein C01B4.6; K01785 aldose 1-epimerase [EC:5.1.3.3] (A)
MASGFIEIANKQGLTATLLPFGATLAKLTFPDKNGKNQDLVLGFDTIDEFEKDAASIGKT
VGRVANRIKNSTLHFDGKQYTMTPNNGPHYLHGGPNGLGYRKWEVVRHAPESVSFSVRAN
EQDDGLPGDAKIDVTYTVNDRNQLIIEHHATCDTPGLLALTNHAYWNLDGSDTVAEHFLE
MEADEFVEVDDTFCPTGAIRSVTDTGFDFRSGKQLKESGKDAEELLDLDNDLVITKKTPP
STPSTYLRFWSEKSGIELSITTSYPVIHLYASKFLDCKGKKGEHYKANKALAIEPQFHSA
APNFDHFPDVSLRPGDHYCQEIVYTFSHVN

BLAST