GenomeNet

>cel:CELE_C10E2.3 hda-4; HDA-4, isoform A; K11406 histone deacetylase 4/5 [EC:3.5.1.98] (A)
MEEASSSTGSAGGAGPSVPNLPSTSEAAIGQTNLEPESIALLQSQLQEYRQKQMDLIGHF
QRAQQELSVQHMHNLYAALQQQQQLQNLQTERSAVNPLLISQQHSTEDQNSGPAAPLSLA
NSLTNLLSSSNGNLSVPQTPTKEHHPTAPTSNRKCDLPRSNSTTISQLTKDRLKNMIANR
SKGESNSQSNLMSNSVTANGNGHDNGRKLKNSNSQVNVSSPHFEPYRLPTSLANAHNLQQ
ASEFQLRKVNSEPNLKMRIRAKLLSKGSSPVQHVQQNNSQFNFTHPQLKRSDSETSQNVP
LDFMQSSSQTNLPHLMLPSPSLPNLAAAGAFHGLNLPVGQDLNAFMAVANLSPFLSLPSL
LNKKLELGGLTDEGDRNGLIGSSSTSSLASNVSMGSHQYQSLLKQQIRDLVLRRKSLVRE
DPEGEGLAELYNGLLPQAKLQQLQALAAESGFLAKQEPTCTTGLGYDQAMVRHECCCGNN
ASHVENGGRIQSIWSKLIEHGHVQKCEKVTAKKASLEQLQLVHSQTYTTFFAVSPTACLK
IDANSLPLKRFLQLPCGGIGVDSDTYFNDASTQTAARLAAGTLIELSSQVAEGRLKNGFA
CIRPPGHHAEHEQAMGFCFFNNVAVAVKVLQTKYPAQCAKIAIIDWDVHHGNGTQLSFEN
DPNVLYMSLHRHDKGNFFPGTGSVTEVGKNDAKGLTVNVPFSGDVMRDPEYLAAWRTVIE
PVMASFCPDFIIVSAGFDACHGHPNALGGYEVTPEMFGYMTKSLLNYASGKVVLALEGGY
DLKSISEAAQQCVQALIGESDDAGRLSSVALESLPNPSAVETLQKVIAIHKSYWPALHGQ
EAAINTTEMQWRNLKLQVQMQQQQQQQQT

BLAST