GenomeNet

>cel:CELE_C26E6.9 set-2; Protein SET-2, isoform A; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MSTHDMNHHPPRKSHSKRDKPSSSNSGPKIENHKCKWAWQKVFETGKSFLRRDGFPQDCK
SKEDFERIKRTGVRKTSENMLEDPRKNFESLQQSSVYQTNSFRNPRYLCRAHLRVDSYYC
TIPPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYVKFATVKEA
HNFYSMYHAQNLLATKCTPRIDPFLSILNEEYEVATNGQVLPILPDDLASIDPSVLRDLR
ANFLRDQNEKYELAMRNTYEDEGGMLSGVIMDTSDHYERDYTMDHDVGPSSMKMSPIPPP
PIKEESPPPPPPPPVASVSNLAPVPSVQLPYYNNIQPSSSTMHMPEFRPTEPPPSYSRED
PYRSTSRSSLSRHRNRSRSPSDGMDRSGRSSSRRTHRRPESRNGSKNANGDVVKYETYKM
EKRKIKYEGGNKKYEQVHIKERTAVIRGKNQLENVSSESASGSSSVDTYPDFSDEERKKK
KRPKSPNRSKKDSRAFGWDSTDESDEDTRRRRSGRSQNRSSERKFQTTSSSSTRRELSST
HTNSVPNLKSHETPPPPPPKGHPSVHLQTPYQHVQPQMIPATYYNLPPQHMAPPPITTSL
PPFCDFSQPPPGFTPTFKPITNAPLPTPYQASNIPQPGLVQIAALSAAPEPFSSIPGPPP
GPAPIQEDVGRAESPEKPSLSERFSGIFGPTQREEPAQVEVEYDYPLKHSESHDDRHSLE
DMDVEVSSDGETVSNVEKIECMEEKKRQDLERIAIARTPIVKKCKKRMMDELSRKVAEDI
RQQIMRQCFAALDEKLHLKAIADEEKRKKEREEKARQEAEKPSNHLIADMMTLYNNQSFA
SSSRGFYRKQKPIPKSHPKHQEHHHHAKASVSTPVHSSSTSRNSSVAPTPQRTVSTSSSS
SSAATSARVSEDESDSDSTPGEVQRRKTSVLSNDKRRRRASFSSTSIQSSPERQRDVSSS
SRTSSSSSTSSMKQEETADEKSRKRKLIMSSDESSTTGSTATSVVSSRQSSLEPQQEKTD
GEPPKKKSQTDFISERVSKIEGEERPLPEPVETSGPIIGDSSYLPYKIVHWEKAGIIEMN
LPANSIRAHEYHPFTTEHCYFGIDDPRQPKIQIFDHSPCKSEPGSEPLKITPAPWGPIDN
VAETGPLIYMDVVTAPKTVQKKQKPRKQVFEKDPYEYYEPPPTKRPAPPPRFKKTFKPRS
EEEKKKIIGDCEDLPDLEDQWYLRAALNEMQSEVKSADELPWKKMLTFKEMLRSEDPLLR
LNPIRSKKGLPDAFYEDEELDGVIPVAAGCSRARPYEKMTMKQKRSLVRRPDNESHPTAI
FSERDETAIRHQHLASKDMRLLQRRLLTSLGDANNDFFKINQLKFRKKMIKFARSRIHGW
GLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGN
FARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAK
TCRGYLN

BLAST