GenomeNet

>cel:CELE_C29A12.3 lig-1; LIG-1, isoform A; K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] (A)
MFFSKAGKAAVEWAKGSKVPYKEFALTLEKIEELSGKKKVDELAQFFTKVLDFSPDDLTA
CVYMSVNQLGPSYEGLELGVAENSLIKAVAKATGRTEGKIKEDLRAKGDLGTVAQQSRSN
QKMLAVPKALTVPTVFNKLTEIAKLSGTSAMNKKVDAISALLIACQGIEARFLVRMLAGK
MRIGLGEQSVLSALGHAFTLSKITDQKVRGDKLDSLKDANVKRVKTAYCECPNYNRLIEV
ALTEGVEALVEKCKLSPGIPLKPMLAHPTKGIDEIMRRFRNQTMTCEWKYDGERGQIHKR
EDGQIFIYSRNQENNTTKYPDIIEKISSCIGDGVTSFIVDAEVVAIDEAGLILPFQVLST
RKRKNATDDNGVKVVVFLFDLLYFNGEPLVRKPLRKRRELLRTNFKKIDGSFYFATSVDT
NDTDEINSFFDEAVQNKCEGLMIKTLDTEATYEISRRSHSWLKMKKDYVDGVGDTLDLVV
MGAYSGVGKRTGVYGGYLLGCYNPTTEEYESVCKIGTGFTDEDLAEQYKILQDKKIDKSP
SYYQFDHTLKPDDTFSPYLVFEVKCADITISPRHKAASGLTDDGKGISLRFPRFLRIRDD
KNSDDATSSEQVLEMYKNQEAFANQKIEKADAVDEDDEFEEKEDEEEELNMTNVSEGSSK
ENPVKEEIKKETPKSVSPKKFEKKPPVKSSPVNKSPVKSSPIKKEAEKKKGPVASIFSSS
TKKNEKDVKVESPSPIRKKKLPSDSDESDEETSTNKKQPAKKRSRVAIDSDSD

BLAST