GenomeNet

>cel:CELE_C29A12.3 lig-1; Protein LIG-1, isoform B; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MFFSKAGKAAVEWAKGSKVPYKEFALTLEKIEELSGKKKVDELAQFFTKVLDFSPDDLTA
CVYMSVNQLGPSYEGLELGVAENSLIKAVAKATGRTEGKIKEDLRAKGDLGTVAQQSRSN
QKMLAVPKALTVPTVFNKLTEIAKLSGTSAMNKKVDAISALLIACQGIEARFLVRMLAGK
MRIGLGEQSVLSALGHAFTLSKITDQKRMP

BLAST