GenomeNet

>cel:CELE_C32D5.5 set-4; Protein SET-4; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MQLHEQIANISVTFNDIPRSDHSMTPTELCYFDDFATTLVVDSVLNFTTHKMSKKRRYLY
QDEYRTARTVMKTFREQRDWTNAIYGLLTLRSVSHFLSKLPPNKLFEFRDHIVRFLNMFI
LDSGYTIQECKRYSQEGHQGAKLVSTGVWSRGDKIERLSGVVCLLSSEDEDSILAQEGSD
FSVMYSTRKRCSTLWLGPGAYINHDCRPTCEFVSHGSTAHIRVLRDMVPGDEITCFYGSE
FFGPNNIDCECCTCEKNMNGAFSYLRGNENAEPIISEKKTKYELRSRS

BLAST