GenomeNet

>cel:CELE_C42D8.5 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (RefSeq) acn-1; Inactive angiotensin-converting enzyme-related protein (A)
MKFHILLLLLVGACLPVFTQEIKPKPELLPADEAPKDPEAVFSEGEPFELTDALDTPKNG
SVPVPEPEPKPEPEPEPEPKPEPEPSPTPEPEPAIKFDNIESEDYGDVAETAASTQPDEL
NTEVIEQLVDTFLNTGSIASNKTNKGPVFANPVAQALVNLTLNHFSSTTSHSSTGSAIPM
KSIRLLLDGTEKELHSLCSEEIPKTRQPGDGGNGLPSEDRVAFPGGECVNGQECLLDSHC
NGTICVCNDGLYTLEIGNTFNCVPGNPADSGFGDGKGGLVIGLFNNEVTTPEPSAEPEPT
AKTTTKMPPRVRAATSPFSLYLTVLLIIYFAL

BLAST