GenomeNet

>cel:CELE_C43E11.4 tufm-2; Protein TUFM-2; K02358 elongation factor Tu (A)
MNPAALSAFTRSLLFNRCSTSSFCNSITRNAVAFFATAAATPKINVNVGTIGHIDHGKTT
LTSAITRVQAKKGFAKHIKFDEIDKGKEEKKRGITINVAHIGYESPLRRYSHTDCPGHSD
FIKNMICGTSQMDVAVLVIAATDGVMEQTKEHLILAKQVGVKNMAIFINKADLVEEDDLD
LVEMEARELLSLHGFNGDATPVIRGSALSALEGQDISCIERLIDALDSLPEPDRNEKDTF
VMPIASKTAITGRGTVIVGTLERGVLKKGDKVEIKGDGQTLQTTASDIQVFGKSVKEVRA
GDHCGVLCRGVKGDTVKRGMWAGHPGAVTITNRVKVELYLLSEAENGRKIGIRTGFTDKM
YCSTWDQVGRFDMSNELLMPGEHTSATVLLMKDMPLRKGMPFTLREGSSKTTIARGIISD
LEDHVAVEKHNLKKSAEKM

BLAST