GenomeNet

>cel:CELE_F01F1.6 alh-9; Protein ALH-9; K14085 aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3] (A)
MNRLLSSGMSAATLQTRMASQLLINDSKYGFLKELGLTENNAGVFHGKWAASGQVVQSFA
PANNSPIANVQNGNVQDYEIAISEAKKAYNDWCEVPAPRRGEIVRQIGDKLRTQLQNLGK
LVSLEMGKISAEGVGEVQEYVDICDYATGLSRSLEGKIFPSERPGHALLEQWNPLGVVGV
ISAFNFPCAVYGWNNALALVTGNSVVWKPAPSTPLTAIAVTKLVEEVLVANNVNPALCSL
VCGEGDVGQALVKDKRVNLVSFTGSSEIGKIVGQQVQARFGKLLLELGGNNAIIVNEDAD
LNMVVPATVFAAVGTAGQRCTTTRRLIVHDKVYDQVLERLKKAYAQFESRIGCPLDSNTI
IGPLHNQQAVGKYKASVAEAVASGGKIEYGGKVLERDGNFVLPTIVTGLKHDSPVVLRET
FAPILYVLKFSTLEEAIAINNEVDQGLSSSLFTTNIQNVFKWMGPKGSDCGIVNVNIPTS
GAEIGGAFGGEKETGGGRESGSDSWRQYMRRSTCTINYSKELPLAQGIKFE

BLAST