GenomeNet

>cel:CELE_F11G11.1 gst-8; Protein GST-8; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MVHYKLSYFPIRGAGEVIRQIFVYAGQSFEDHRISIEEWAAVKPTTPFGQLPLLEVDGKV
LPQSHSIARFLARQFGINGKCAWEEAQVNSIADQFKDYRNEVRPYVMVKMGFAEGDLDAL
SKDVFLPGFKKHYGFIYNFLKTAGSGYLVGDSLTFVDLLIAQHTADILSTDPALLEEFPQ
FKAHQEKVHSNANIKKWLETRPETQF

BLAST