GenomeNet

>cel:CELE_F14B4.2 F14B4.2; Protein F14B4.2, isoform A; K00844 hexokinase [EC:2.7.1.1] (A)
MSSIVCHPILDSQNGIATDAVIKKQRPPPLVLSRPKDLIQEACQRLVLSDQQLRRIMQSM
EKSMEQGLATSTKKVAVKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKLQGKETKM
TGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKG
KLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQI
GVIVGTGTNACYMERLDRIPKLAGYVDEHGVTPEEMIINTEWGAFGDDGALDFLRTEWDE
VVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGNSDAISVPHCFPTKFVS
EIDSDLLEDDDRTFQKTYQILEDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLL
NRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAAV
ATRLKEEKLAASLSSSSSNQ

BLAST