GenomeNet

>cel:CELE_F41H10.6 hda-6; Protein HDA-6, isoform B; K11407 histone deacetylase 6/10 [EC:3.5.1.98] (A)
MLFEDRQKNRSTGPTLIGFNQTQNEHENTVCPTHPESSDRILKIKEALTKTKILEKCTVL
TNFLEIDDADLEVTHDKSMVKDLMESEKKTQEDINSQCEKYDSVFMTENSMKVAKDGVAC
VRDLTNRIMANEASNGFAVVRPPGHHADSVSPCGFCLFNNVAQAAEEAFFSGAERILIVD
LDVHHGHGTQRIFYDDKRVLYFSIHRHEHGLFWPHLPESDFDHIGSGKGLGYNANLALNE
TGCTDSDYLSIIFHVLLPLATQFDPHFVIISAGFDALLGDPLGGMCLTPDGYSHILYHLK
SLAQGRMLVVLEGGYNHQISAVAVQRCVRVLLGYAPFSIELNEAPKESTVDSCVSLVSVL
RHHWNCFDYFPSRTSLRLAQWPIVNTKVIYNYDPTTRRADTGEIIQDELASTEFTASDVI
PTENMETLIYFNEGDDAHFDLEEDNHPEKPARTRRILKTLRESGVLEKCVDRNCERIATN
EEIRLVHTKKMLEHLRTTETMKDEELMEEAEKEFNSIYLTRDTLKVARKAVGAVLQSVDE
IFEKDAGQRNALVIVRPPGHHASASKSSGFCIFNNVAVAAKYAQRRHKAKRVLILDWDVH
HGNGTQEIFYEDSNVMYMSIHRHDKGNFYPIGEPKDYSDVGEGAGEGMSVNVPFSGVQMG
DNEYQMAFQRVIMPIAYQFNPDLVLISAGFDAAVDDPLGEYKVTPETFALMTYQLSSLAG
GRIITVLEGGYNLTSISNSAQAVCEVLQNRSMLRRLREEKEQFATKPQKIESSCIKTIRE
VCAVQQKYWSILKGFQVTPSNYGLDIDDEAYDDDSIDMADQSSSSGSSSSSTRPSHNLEI
MDSGPAHAVVPLATCPHLKEVKPLPPAKINARTACSECQIGAEVWTCLTCYKYNCGRFVN
EHAMMHHLSSSHPMALSMADLSVWCYPCDSYVHNPALIGAKSAAHESKFGETMPS

BLAST