GenomeNet

>cel:CELE_F42A8.2 K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] | (RefSeq) sdhb-1; Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial (A)
MLARSARLLHSAELAANAIRAASGAPATAAAAEASFPSTDDVAAKTKKTGNRIKTFEIYR
FNPEAPGAKPTVQKFDVDLDQCGTMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIG
GQNTLACICKIDSDTSKSTKIYPLPHMFVVKDLVPDMNLFYAQYASIQPWIQKKTPLTLG
EKQMHQSVAERDRLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWVIDSRDDY
ATERLHRMHDSFSAFKCHTIMNCTKTCPKHLNPAKAIGEIKSLLTGFTSKPAAEPSAF

BLAST