GenomeNet

>cel:CELE_F42A8.2 sdhb-1; Protein SDHB-1; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MLARSARLLHSAELAANAIRAASGAPATAAAAEASFPSTDDVAAKTKKTGNRIKTFEIYR
FNPEAPGAKPTVQKFDVDLDQCGTMILDALIKIKNEVDPTLTFRRSCREGICGSCAMNIG
GQNTLACICKIDSDTSKSTKIYPLPHMFVVKDLVPDMNLFYAQYASIQPWIQKKTPLTLG
EKQMHQSVAERDRLDGLYECILCACCSTSCPSYWWNADKYLGPAVLMQAYRWVIDSRDDY
ATERLHRMHDSFSAFKCHTIMNCTKTCPKHLNPAKAIGEIKSLLTGFTSKPAAEPSAF

BLAST