GenomeNet

>cel:CELE_F55G7.2 F55G7.2; Protein F55G7.2; K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] (A)
MDLFQIQNHEENNVDKIESKMLEDETDLLHETLSTVFPNGKSIKFDSHKHHVPVILLNML
KELFEPVLNQLSIELIAANGKTTNTDNVLAELAKFNEAVALFRRDNPKKQLLLPKHWDQS
TCTQQVAQKITEIAKDLSVPYPKKLNQHYKGFSSETYGETMLEQIGSIVDELKLNSSDVF
VDLGSGIGQLVCFVAAYSKVKKAVGIELSSVPAEYAVSQGMYFKNLMTFFDKQHGEIELI
QGDFLHPQFHDLICKEATVIFINNYAFEDDLTRRIVFELLQNCADGTRIVSAKPLSLPRS
VASRRHAMSDFGSMSNSRTLRATESNVSWTSNIVEFTLTTVDHLKLFKSFEMQKESKKSA
NSKVKKVGKDFTKTSLKNKKESK

BLAST