GenomeNet

>cel:CELE_K08F4.11 gst-3; Protein GST-3; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MVHYKLTYFNARGLAEISRQLFHMAGVEFEDERINEEKFSQLKPTFPSGQVPILCIDGAQ
FSQSTAIARYLARKFGFVGQTAEEELQADEVVDTFKDFIESFRKFVIAVLSGESEEILKN
IREEVIKPAVKTYTAYLKAILEKSSSGYLVGNELTWADLVIADNLTTLINAELLDIENDK
LLKEFREKIIETPKLKEWLAKRPETRF

BLAST