GenomeNet

>cel:CELE_R03D7.6 gst-5; Protein GST-5, isoform B; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MVSYKLTYFNGRGAGEVSRQIFAYAGQQYEDNRVTQEQWPALKETPEISKSCN

BLAST