GenomeNet

>cel:CELE_R107.7 gst-1; Protein GST-1; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTLKLTYFDIHGLAEPIRLLLADKQVAYEDHRVTYEQWADIKPKMIFGQVPCLLSGDEEI
VQSGAIIRHLARLNGLNGSNETETTFIDMFYEGLRDLHTKYTTMIYRNYEDGKAPYIKDV
LPGELARLEKLFHTYKNGEHYVIGDKESYADYVLFEELDIHLILTPNALDGVPALKKFHE
RFAERPNIKAYLNKRAAINPPVNGNGKQ

BLAST