GenomeNet

>cel:CELE_Y37D8A.23 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) unc-25; Uncharacterized protein (A)
MSSAAADESDAVLENLIAKEILPQTGNWEGTEEFLNRIVQVLLKYIKDQNDRDQKILEFH
HPDKMQMLMDLSIPEKPESLLKLVKSCEDVLRLGVRTGHPRFFNQISCGLDLVSMAGEWL
TATANTNMFTYEIAPVFILMEKSVMARMWEAVGWDPEKADGIFAPGGAIANLYAMNAARH
QLWPRSKHLGMKDIPTLCCFTSEDSHYSIKSASAVLGIGADYCFNIPTDKNGKMIPEALE
AKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPE
HRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVS
FDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIE
NPEFLNICFWYVPSKIRNLEPAEMRARLEKIAPKIKAGMMQRGTTMVGYQPDKQRPNFFR
MIISNQAITREDLDFLIKEIVDIGESLE

BLAST