GenomeNet

>cel:CELE_Y37D8A.23 unc-25; Protein UNC-25, isoform B; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MSSAAADESDAVLENLIAKEILPQTGNWEGTEEFLNRIVQVLLKYIKDQNDRDQKILEFH
HPDKMQMLMDLSIPEKPESLLKLVKSCEDVLRLGVRTGHPRFFNQISCGLDLVSMAGEWL
TATANTNMFTYEIAPVFILMEKSVMARMWEAVGWDPEKADGIFAPGGAIANLYAMNAARH
QLWPRSKHLGMKDIPTLCCFTSEDSHYSIKSASAVLGIGADYCFNIPTDKNGKMIPEALE
AKIIECKKEGLTPFFACCTAGSTVYGAFDPLERVANICERHKLWFHVDAAWGGGMLLSPE
HRYKLAGIERANSVTWNPHKLMGALLQCSACLFRQDGLLFQCNQMSADYLFQQDKPYDVS
FDTGDKAIQCGRHNDVFKLWLMWKSKGMEGYRQQINKLMDLANYFTRRIKETEGFELIIE
NVSFARIPEHLFLVRAFKDSKLGAC

BLAST