GenomeNet

>cel:CELE_Y41D4B.12 set-23; Protein SET-23, isoform B; K11433 histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43] (A)
MCLHTAPNFITCEMAKGFGVRAGEQIAAGEFVCEYAGECIGEQEVERRCREFRGDDNYTL
TLKEFFGGKPVKTFVDPRLRGNIGRFLNHSCEPNCEIILARLGRMIPAAGIFAKRDIVRG
EELCYDYGHSAIEGENRKLCLCKSEKCRKYLPMSATPIE

BLAST