GenomeNet

>cel:CELE_Y46G5A.31 gsy-1; Protein GSY-1; K00693 glycogen(starch) synthase [EC:2.4.1.11] (A)
MPDHARMPRNLSSNKIAKTIAGEDLDEEEVLEMDAGQSAREEGRFVFECAWEVANKVGGI
YTVLRSKAQISTEELGDQYCMFGPMKDGKWRLEVDPIEPENRTIRAAMKRFQADGFRCMY
GRWLIEGYPKVILFDLGSGAVKMNEWKHELFEQCKIGIPHEDIESNDAVILGFMVALFLK
HFRESVTSYTPLVVAHFHEWQAGVGLLMTRLWKLDIATVYTTHATLLGRHLCAGGADLYN
NLDSFDLDAEAGKRKIYHQYCLERAACQTAHIFTTVSEITGLEAEHFLCRKPDVLTPNGL
NVVKFAALHEFQNLHAQNKEKINQFIRGHFHGHLDFDLDKTLYFFTAGRYEFSNKGGDMF
IESLARLNHYLKTTSDPRHMGVTVVAFLIYPAPANSFNVESLKGQAVTKQLKEAVDRIKE
KVGQRIFDICLQGHLPEPEELMSPADNILLKRCIMSLHNSSLPPICTHNMIRADDPVLES
LRRTSLFNKPEDRVKVVFHPEFLSSVSPLIGLDYEDFVRGCHLGVFPSYYEPWGYTPAEC
TVMGIPSVSTNLSGFGCFMQEHVEDHEQKGIYVIDRRHKAAEESVQELAQVMYDFCGQSR
RQRIILRNSNEGLSALLDWQNLGVFYRDCRRLALERLHPDVDKIMRDNEGKVPSAATSRR
PSIHSSDGEDDE

BLAST