GenomeNet

>cfa:477718 NDUFA9; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa; K03953 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 (A)
MAAAAHPRLVRALPMSRSSITARATAMFHGPLRRQLHHALIPHGKGGRSSVSGVVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIQRAV
KHSNVVINLIGREWETKNFDFEDVFVKIPQAIAKVSKEAGVEKFIHVSHLNADIKSSSRY
LRNKAVGEKEVRDAFPEAIIIKPSDIFGREDRFLNHFANTRWFGGVPLISLGKKTVKQPV
YVVDVSKGIVNAIKDPDAKGKSFAFVGPNRYLLFDLVQYVFAMAHRPFLPYPLPHFAYRW
VARLFEMSPFEPWTTRDKVERLHITDMILPHLPGLEDLGIQASPLELKAIEVLRRHRTYR
WLLSEIEDVKPAKTVNF

BLAST