GenomeNet

>cfa:477718 K03953 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9 | (RefSeq) NDUFA9; NADH:ubiquinone oxidoreductase subunit A9 (A)
MAAAAHPRLVRALPMSRSSITARATAMFHGPLRRQLHHALIPHGKGGRSSVSGVVATVFG
ATGFLGRYVVNHLGRMGSQVIIPYRCDPYDTMHLRPMGDLGQIIFLEWDGRNKDSIQRAV
KHSNVVINLIGREWETKNFDFEDVFVKIPQAIAKVSKEAGVEKFIHVSHLNADIKSSSRY
LRNKAVGEKEVRDAFPEAIIIKPSDIFGREDRFLNHFANTRWFGGVPLISLGKKTVKQPV
YVVDVSKGIVNAIKDPDAKGKSFAFVGPNRYLLFDLVQYVFAMAHRPFLPYPLPHFAYRW
VARLFEMSPFEPWTTRDKVERLHITDMILPHLPGLEDLGIQASPLELKAIEVLRRHRTYR
WLLSEIEDVKPAKTVNF

BLAST