GenomeNet

>cfa:479077 K11424 histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43] | (RefSeq) NSD2, WHSC1; nuclear receptor binding SET domain protein 2 (A)
MEFSIKXNPLSVQKVVECIKMKQAPEILGNTNGKTQNCEVNRECSVFLSKAHLSTSLQEG
VMQKFNGHDALPFIPSEKLKDLTSRVFNGEPGAHDAKLRFESQEGKGLGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDGAAAVSQSEENGQKAENKARRSRKRSIKYDSFLE
QGLVEAALVSKISSPSDKKIAAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMV
SADPLLHNYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQ
APTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSIEERKAKFTFLYVGDQLHLNPHVA
KEASIAVESPAQVVESSGVIEEAADNPKSLREEGIPIKRRRRAKLSGSAENQESEPGTVK
STPQKVAEADPKRGVGCPPGRKKSVASTPRSRKGDAASRFLVFCQKHRDEVVAEHPDASG
EEIEELLGSQWDMLNEKQKARYNTKFALVASSQSEEDSGNINGKKRIHTKRTQEPTEDAD
GEDAPRKRLRTDKHGLRKRETINDKTARTSSCKAIEAASSLKSQAATKHLSDACKPLKKR
NRASTAASSTPFSKSSSPSASLTENEVSDGPGDEPLESPYESADETQTEVSISSKKSERG
VTAKKEYVCQLCEKTGSLVLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVCK
ESKTDVKRCVVSQCGKFYHEACVRKYPLAVFESRGFRCPLHSCVSCHASNPSNPRPSKGK
MMRCVRCPVAYHGGDACLAAGCSVIASNSIICTGHFTARKGKRHHAHVNVSWCFVCSKGG
SLLCCESCPAAFHPDCLNIDMPDGSWFCNDCRAGKRLHFQDIIWVKLGNYRWWPAEVCHP
KNVPPNIQNLKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNA
LQEAEARFREIKLQREARETQENERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPT
DENPCGFDSECLNRMLMFECHPQVCPAGEYCQNQCFTKRQYPETKIIKTDGKGWGLVAKR
DIRKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMN
HSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGF
LGDRPKTSASLSSDEKGKKTKKRTRRRRTRGEGKKESEDECFRCGDGGQLVLCDRKSCTK
AYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHFCPNSFCKEHQDGTAFSSTQDGRS
YCYEHDLGAESARSTKTEKPFPEPMKSKGKRKKRRCWRRVTEGK

BLAST