GenomeNet

>cfa:480516 EZH1; enhancer of zeste 1 polycomb repressive complex 2 subunit; K17451 histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43] (A)
MDMPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMRPASGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDDEEEGHNDTSDGKQDDNKEDLPVTRKRKRHALEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHREWGYSKILSCSPFPNTTSFYTQRDAEIQIEPEPCGTDCFLLLEGAKEYA
MLHNPRSKCSGRRRRRHHMVSASCSNTSASTVAETKEGDSDRDTGNDWASSSSEANSRCQ
TPTKQKASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQV
FQFAVKESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPD
RPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLT
CGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELIS
QDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHR
IGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL

BLAST