GenomeNet

>cfa:489916 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) SETD1A; SET domain containing 1A (A)
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTESRRRSSSDTAAYPAGTTGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAVSATTAATASSSSSSSSSTSSSSLSSSSSSSSSS
SSSHFRGTDSNYPAYYESWNRYQRHASYPPRRATREEPPGASFAENTAERFPPSYTSYLP
PEPSRPADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPE
TTNESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEESSTTGPSSRDTGSEAPPGS
GHGPCTPPPAPANFEDVAPTGSGEPGAPRESPKANGQNQASPCSSGEDMEISDDDRGGSP
PPAPTPPQQPPPPPPPPPPHPPYLASLPLAYPPHQRAYLFPPRPDGPPPPEYPPPPPPPP
HIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEA
FLPFPPPQEAAYGLPYALYTQGQEGRGAYSREAYHLPLPVAAEPLPSSSVSGEEARLPPR
EEAELAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKA
KPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFK
VKRKEPSEISEASEEKRPRPSTPAEEDEDDPERDKEAGEPGRPGTKPPKRDEERSKTQGK
HRKSFALDSEGEEASQESSSEKEEEEEEEDEEDEEREEAMDAAKKETEASDGEDGESDSS
SKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEPPATV
PSASPPPRDVPAPPPAPAEEPEPERVAGSPAMPLPEQEKSPARPAGSTEEPPPSVPQPPP
EPPAGPLAPVPRPDERPSSPIPLLPPPKKRRKTVSFSALEEVPAPEPPPATPPQIKSPGP
VSRKVPRTVERTIRNLPLDHASLVKSWPEEVSRGGRSRAGGRGRSTEEEEADPGTEVDLA
VLADLALTPARRGLTALPPGDDSEATETSDEADRPGPLLSHILLEHNYALAVKPPPSTPA
PRPLEPVPAPAALFSSPADEVLEAPEVVVAEAEEPKQQQQQQQQQEEGEEEEEEEEESES
SESSSSSSSDGEGAVRRRSLRSHTGQGGQPPPPXPPSPPSFEPRSEFEQMTILYDIWNSG
LDLEDMGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSA
RSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAIGTSAIMD
SDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRY
VQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPI
GVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN

BLAST