GenomeNet

>cfa:610668 ACE, DCP1; angiotensin-converting enzyme-like; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MGAAPGRPGRGPLPLPLPLLLLLPLLLPPPPPPAALALDPELQPGNFAADEAGAQLFVQS
FNSSAELVMYQSTVASWAYDTNITEENARRQEEAALLNQEFAEVWGQKAKELYDPIWQNF
SDPVLRRVISGVRTLGPANLPVEKRQQYNALLSNMNRIYSTARVCFYPNKTAICWSLDPE
LTHIMAISRNYALLLYAWEGWHNAVGTPLKPLYQNFTVLSNEAYQKDGFSDTGAYWRSWY
ESPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWD
NLYDMMVPFPDKPSLDVTSTMVRKGWNTTHMFRVAEEFFTSLGLSPMPPEFWAGSMLEKP
TDGREVVCHASAWDFYNRRDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKEQPVSLRQG
ANPGFHEAIGDVLALSVSTPAHLYKIGLLDNVSNDIESDINFLLKMALEKIAFLPFGYLV
DQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVARNETHFDAGAKFHVPNVTPYIRYF
VSFVLQFQFHQALCKEAGHQGPLHTCDIYQSTQAGAKLREALRAGSSRPWQDVLREAIGS
DTLDAQPLLDYFQPVSRWLQEQNKRNGEVLGWPEYQWRPPMPNNYPQDIGLVTDEVEARR
FVEEYDRRSLVIWNEYAEANWNYNTNITTETSKILLQKNIQMANHTFKFGTWARQFDVTN
FQNASIKRMIKKIQDLERAALPAKELEEYNKILLDMETTYSVASVCHTNGTCLQLEPDLT
NLMATSRKYEDLLWAWKSWREKVGRAILPFFPKYVELANKAARLNGYEDAGDSWRAMYEM
PSLEQDLEQLYQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWGQTWSNI
YDLVVPFPSAPKIDATEAMIKQGWTPKRMFEEANNFFTSLGLLPVPFEFWNKSMLEKPTD
GREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGAN
PGFHEAIGDVLALSVSTPKHLHSINLLSSESGGYEQDINFLMKMALDKIAXVPFSYLVDQ
WRWRVFDGSITKENYNQEWWNLRLKYQGLCPPVARSQGDFDPGAKFHVPSSVPYIRYFVG
FVIQFQFHEALCQAAGHKGPLHTCDIYQSKEAGKRLEDAMKLGFSKPWPEAMKLITGQSN
MSASAMMNYFKPLLDWLLTENGRHGEKLGWPQYNWTPNSARSEGPLPGTGRVNFLGLDLE
EQQARVGQWVLLFLGVALLVATLGLTQRLFSIRHHSLRRPHRGPQFGSEVELRHS

BLAST