GenomeNet

>cfl:Cfla_0584 DNA polymerase LigD, polymerase domain protein (A)
MAQTPAVELDVHGRTVRVSSPDRVVFPERGLTKLDVVEYFLAVGDGILGALLHRPTTLER
WPKGVFEGARMSTRQDSSGDAFYQKRVPQGAPGYVETARIAFPSGRTADEVAPTELAVVA
WAANLGTLTFHPWPVVRDDVDAPDQVRIDLDPQPGTDFADAARVAPHVRELLAEHGLEGH
PKTSGGRGLHVFVPIEPRWSFTDARRATIAFGRELERRLPGQVTMKWWKEERGVKIFVDY
NQMARDRTIASAYSIRSNPRATVSAPLTWDEVGDVHPDDFDVLTMPARFAAVGDLHAPLV
AHAAPRHGLDSLLELADRQEHEDGHGDLPYPPEYPKMPGEPKRVQPSKDRDRPR

BLAST