GenomeNet

>cfl:Cfla_1219 2-oxoglutarate dehydrogenase, E1 subunit; K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2] (A)
MTQNAQSDSTRADFGANEWLVDELYEQYLKDRNAVDPAWWDFFEGYKPETTGAATNGETK
DAPRATAAPPAPAQPTTARTPAAPAVPAAPPAPPVEVTPSPVATAQPATAPYAEAATRRT
DAPEVQAVDDVQKLRGPAARVVTNMEASLEVPTATSVRAVPAKLMVDNRIVINNHLSRGR
GGKVSFTHLIGFALVEAVQEMPAMNAAYTLVDGKPGVLQPAHVNLGLAIDLAKPDGSRQL
LVPSIKKAETLDFAQFWTAYEDVVRRARNSKLTVDDFAGTTISLTNPGTIGTVHSVPRLM
QGQGTIVGVGAMDYPAEFAGTSDEQLNRMGVSKVLTVTSTYDHRIIQGAQSGDFLRILGR
KLLGEDGFYDRVFAALRVPYEPVRWVRDANHDPDAEAIKPARVAELIHAYRSRGHLMAET
DPLAYRQRKHPDLDVQNHGLTLWDLDRTFPTGGFTGRTRATLREVLGLLRDSYCRTVGVE
YMHLQDPRQRRWLQERLESGYARTPREDQLRILRRLNAAEAFETFLQTKFVGQKRFSLEG
GESLIPLLDAILSRAADGGLDEVGIGMAHRGRLNVLANIAGKSYGQIFSEFEGNQDPKSV
QGSGDVKYHLGTEGVFTAESGATTAVYLAANPSHLEAVDPVLEGIVRAKQDRIDLGGDGF
SVLPILIHGDAAFAGQGVVFETLNLAQLRGYRTGGTIHVIVNNQVGFTTGPSSSRSSQYA
TDVAKGLQVPIFHVNGDDPEAVVRVAELAFEYREQFDRDVIIDMVCYRRRGHNEGDDPSM
TQPLMYNLIEAKRSVRKLYTETLVARGDITLEEAEQALRDYQSQLERVFTETREDGWTPP
PADVETVAGLERPESQQEDAGVMVGWQTAVPTSILQRIGQAHVSPPEGFTVHPKLAQMLA
KREQMSREGGIDWGFGEILAFGSLLIEGTPVRLAGQDSRRGTFVQRHAVLHDRETGAEWT
PLLYLSGDQAKFWVYDSSLSEYAALGFEYGYSVERPDALVLWEAQFGDFVNGAQTVIDEF
ISSAEQKWAQRSSVVLLLPHGYEGQGPDHSSARIERFLQLAAEDNMTIAQPSTPASHFHL
LRRQAYQRPRRPLVVFTPKSMLRLKSASSDVQDFTSGTFRTVIGDDLAAAKADQVTRVLL
CSGKVYWDLLAQRVAANDQQTAIVRFEQLYPLEPDAIAEALAPFGDAELVWVQDEPRNQG
PWTFVSTHLPQVVGREVRVVSRPESASPAAGSAKKHAVEQKSLVTEAFAR

BLAST