GenomeNet

>cga:Celgi_0324 DNA polymerase LigD, polymerase domain protein (A)
MPTSVAGPTLGGMPSSTPAIEIDVRGRAVRVSSPDKVYFPERGLTKRDVVEYFVAVGDGI
LAALLDRPTTLERWPKGVFEGARLATRADSSGDAFYQKRVPAGAPDYVRTARIGFPSGRT
ADEVAPSELAVVAWAANLGTLTFHPWPVTSQDVDRPDQLRIDLDPQPGTDFSDAAWVAPH
VRELLAEHGLEGWPKTSGGRGIHVFVPIEPRWTFVAARRATIAFGRELERRLPTRVTMKW
WKEERGERIFVDYNQMARDRTIASAYSVRSNPRATVSAPLRWDEVGDVHPDDFDVLTMPA
RFADVGDLFAPLAAHAPGRFSIESLLELADRQERDEGHTDLPYPPEYPKMPGEPPRVQPS
RARPT

BLAST