GenomeNet

>cga:Celgi_1453 Thymidine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAELVFFSGTMDCGKSTLALQMHHNHAARGRDGVLFTRHDRAGTATISSRLGLTKQAHEV
DDATDFWHEVIARRTHGRPVDYLIGDEAQFYTAAQVEQLARVVDELGVDVYAFGISTDFR
ARLFPGAQRFVELADRVDVLQVRALCWCGARATHNARVVGGRMVVEGAQVVVGDVGGADG
TAEAADEVQYEVLCRRHHMRRMTAATARAAAPSPQTLTAALLGAEAVEV

BLAST