GenomeNet

>cga:Celgi_1690 DNA polymerase LigD, ligase domain protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MQPMLATPAPSGVLPRGAAWAFEVKWDGVRVLAEVEGGLVRLLSRTGRPVTPAYPELAGL
AHLPDVLLDGEVVALEGGVPSFAAIADRMHVRDPRRAAELARVRPVTFMVFDVLRVAGAD
VVERPYDERRRLLEALDLPEHVLLSPVHDDGDGLWDVTRAHGLEGVVAKRRASPYRPGAR
SGDWVKAAHRRTRTAYVAGWRPEQGGSGRLGALLLGAPDRDGALRFLGRAGSGVSGPLAT
RLRTSALGLARDTSPFADTVPAVDARGSHWCVPELVVDVRYLGRGREGRLRQPVVRGLRD
DATVDPWEQE

BLAST