GenomeNet

>cga:Celgi_1690 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase LigD, ligase domain protein (A)
MQPMLATPAPSGVLPRGAAWAFEVKWDGVRVLAEVEGGLVRLLSRTGRPVTPAYPELAGL
AHLPDVLLDGEVVALEGGVPSFAAIADRMHVRDPRRAAELARVRPVTFMVFDVLRVAGAD
VVERPYDERRRLLEALDLPEHVLLSPVHDDGDGLWDVTRAHGLEGVVAKRRASPYRPGAR
SGDWVKAAHRRTRTAYVAGWRPEQGGSGRLGALLLGAPDRDGALRFLGRAGSGVSGPLAT
RLRTSALGLARDTSPFADTVPAVDARGSHWCVPELVVDVRYLGRGREGRLRQPVVRGLRD
DATVDPWEQE

BLAST